PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy003521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 358aa    MW: 39382.3 Da    PI: 7.9025
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-171a-Arachis_hypogaea-13998PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32360260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
               dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Ahy003521  3 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 60
               8****************************************.***************85 PP

2WRKY105.13.8e-33178235259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                dDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Ahy003521 178 DDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 235
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.456161IPR003657WRKY domain
SMARTSM007742.5E-34260IPR003657WRKY domain
SuperFamilySSF1182901.57E-24261IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-26261IPR003657WRKY domain
PfamPF031065.3E-25359IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-37162237IPR003657WRKY domain
SuperFamilySSF1182902.09E-29169237IPR003657WRKY domain
PROSITE profilePS5081138.297172237IPR003657WRKY domain
SMARTSM007742.9E-37177236IPR003657WRKY domain
PfamPF031061.7E-26178235IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
XSDDGYNWRK YGQKLVKGSE FPRSYYKCTH PNCEVKKLFE RSHDGQITEI IYKGTHDHPK  60
PQPNRRYSAG SIMSMQDERS DKVSFAGRDD KVSNIYGQVS HVAEPGSTPE LSPGAASVDS  120
PEGAGLASNK INDELDDDDP FSKRRKMDLG CTDITPVVKP IREPRVVVQT LSEVDIWDDG  180
YRWRKYGQKV VRGNPNPRSY YKCTNAGCPV RKHVERASHD PKAVITTYEG KHNHDVPTAK  240
NSSHDMAGQA ASIGQARIRP EESDTISLDL GMGLNQAAEN GSSGQGRVPL SEFGGSQTHT  300
SNSSFKFVHA TSAPVYFGVL NNGSIPSYGS RENLSDSTSL NHSTYPCPQN MGRILTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-363237877Probable WRKY transcription factor 4
1wj2_A1e-363237877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177973.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-151WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A0B2SFN70.0A0A0B2SFN7_GLYSO; Putative WRKY transcription factor 20
TrEMBLA0A0R0IVV50.0A0A0R0IVV5_SOYBN; Uncharacterized protein
TrEMBLA0A151S5230.0A0A151S523_CAJCA; Putative WRKY transcription factor 20
STRINGGLYMA08G43770.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-152WRKY family protein